Invitrogen™ Human CC2D1B (aa 203-300) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94309	100 μL

Catalog No. RP94309 Supplier Invitrogen™ Supplier No. RP94309

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55636. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription factor that binds specifically to the DRE (dual repressor element) and represses HTR1A gene transcription in neuronal cells.

Specifications

• Accession Number: Q5T0F9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 200014
• Name: Human CC2D1B (aa 203-300) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A830039B04Rik; CC2D1B; coiled-coil and C2 domain containing 1B; coiled-coil and C2 domain-containing protein 1B; Five prime repressor element under dual repression-binding protein 2; FRE under dual repression-binding protein 2; Freud2; freud-2; KIAA1836; RGD1306630
• Common Name: CC2D1B
• Gene Symbol: CC2D1B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LESQLASVRRGRKINEDEIPPPVALGKRPLAPQEPANRSPETDPPAPPALESDNPSQPETSLPGISAQPVSDLDPDPRALLSSRQREYKVAALSAKRA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining