Invitrogen™ Human CCDC114 (aa 331-420) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98955	100 μL

Catalog No. RP98955 Supplier Invitrogen™ Supplier No. RP98955

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60012. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CCDC114 gene, located on chromosome 19, encodes a protein that is a key component of the structure and function of cilia, which are hair-like organelles present on the surface of many cell types. Structurally, CCDC114 belongs to the coiled-coil domain-containing family, which plays crucial roles in cellular organizations and motility. Functionally, CCDC114 is involved in forming the outer dynein arm of cilia, essential for their motility. Mutations in CCDC114 can lead to defects in ciliary structure, resulting in primary ciliary dyskinesia (PCD), a condition characterized by chronic respiratory tract infections, abnormal organ positioning, and other symptoms. Specifically, mutations like c.742G>A and c.584T>C have been identified to cause variant forms of PCD, as well as situs inversus, which is a complete mirror image reversal of the body's internal organ arrangement. Genetic investigations have shown that these mutations can significantly disrupt the function of cilia, confirming CCDC114's critical role in human ciliopathies.

Specifications

• Accession Number: Q96M63
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 93233
• Name: Human CCDC114 (aa 331-420) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Ccdc114; CILD20; coiled-coil domain containing 114; coiled-coil domain-containing protein 114; RGD1308141
• Common Name: CCDC114
• Gene Symbol: CCDC114
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKDDQHLLQEQQQKVLQQRMDKVHSEAERLEARFQDVRGQLEKLKADIQLLFTKAHCDSSMIDDLLGVKTSMGDRDMGLFLSLIEKRLVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining