Invitrogen™ Human CCDC42B (aa 9-82) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100771	100 μL

Catalog No. RP100771 Supplier Invitrogen™ Supplier No. RP100771

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61765. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CFAP73 may play a role in ciliary/flagellar motility by regulating the assembly and the activity of axonemal inner dynein arm.

Specifications

• Accession Number: A6NFT4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 387885
• Name: Human CCDC42B (aa 9-82) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CCDC42B; CFAP73; cilia and flagella associated protein 73; Cilia- and flagella-associated protein 73; coiled-coil domain containing 42B; coiled-coil domain-containing protein 42B; MIA2
• Common Name: CCDC42B
• Gene Symbol: CFAP73
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FRLALQEKLSTKLPEQAEDHVPPVLRLLEKRQELVDADQALQAQKEVFRTKTAALKQRWEQLEQKERELKGSFI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining