Invitrogen™ Human CCL27 (aa 34-109) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108159	100 μL

Catalog No. RP108159 Supplier Invitrogen™ Supplier No. RP108159

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84941. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCL27 gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation.

Specifications

• Accession Number: Q9Y4X3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10850
• Name: Human CCL27 (aa 34-109) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ALP; AW558992; CC chemokine ILC; C-C motif chemokine 27; C-C motif chemokine ligand 27; Ccl27; Ccl27a; chemokine (C-C motif) ligand 27; chemokine (C-C motif) ligand 27A; CTACK; CTAK; cutaneous T-cell attracting chemokine; cutaneous T-cell-attracting chemokine; ESkine; IL-11 R-alpha-locus chemokine; IL-11 Ralpha-locus chemokine; ILC; PESKY; SCYA27; Scya27a; Skinkine; skinskine; small inducible cytokine A27; small inducible cytokine A27a; small inducible cytokine subfamily A (Cys-Cys), member 27; small-inducible cytokine A27
• Common Name: CCL27
• Gene Symbol: CCL27
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining