Invitrogen™ Human CCR7 (aa 25-58) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108001	100 μL

Catalog No. RP108001 Supplier Invitrogen™ Supplier No. RP108001

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111719. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCR7 is a member of the G-protein-coupled chemokine receptor family with seven membrane-spanning domains and functions as a receptor for 6Ckine/SLC (secondary lymphoid-tissue chemokine), CCL19 and CCL21. CCR7 has been shown to be internalized via clathrin-coated pits and the majority recycled back to the plasma membrane. CCR7 is expressed on T cells and can be used to distinguish populations of naive from central and effector memory T cells. CCR7 has been shown to play a role in migration of memory T cells to inflamed tissue. Expression of CCR7 is also found on DC's. During DC maturation CCR7 expression increases and is thought to be involved in a variety of functions: chemotaxis to the lymph node, cellular architecture, rate of endocytosis, survival and maturation.

Specifications

• Accession Number: P32248
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1236
• Name: Human CCR7 (aa 25-58) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BLR2; Bukitt's lymphoma receptor 2; CC chemokine receptor 7; C-C chemokine receptor type 7; C-C CKR-7; C-C motif chemokine receptor 7; CC-CKR-7; CCR7; CCR-7; CD197; CDw197; chemokine (C-C motif) receptor 7; chemokine (C-C) receptor 7; Cmkbr7; EBI1; Ebi1h; EBV-induced G protein-coupled receptor 1; EBV-induced G-protein coupled receptor 1; Epstein-Barr virus induced gene 1; Epstein-Barr virus-induced G-protein coupled receptor 1; EVI1; lymphocyte-specific G protein-coupled peptide receptor; MIP-3 beta receptor
• Common Name: CCR7
• Gene Symbol: Ccr7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining