Invitrogen™ Human CD103 (aa 32-163) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108890	100 μL

Catalog No. RP108890 Supplier Invitrogen™ Supplier No. RP108890

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140223. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD103, also known as ITGAE or Integrin alpha E, is a molecule that non-covalently associates with integrin beta 7 to form a heterodimeric integral membrane protein. This protein is part of the integrin family, characterized by an alpha chain and a beta chain. Specifically, CD103 includes a 150 kDa alpha chain and a 120 kDa beta chain, with the alpha integrin undergoing post-translational cleavage in the extracellular domain to yield disulfide-linked heavy and light chains. CD103 is primarily expressed on mucosa-associated T lymphocytes, intraepithelial lymphocytes (IELs), and activated cells, as well as a subset of TGF beta-1 cells. It is preferentially found in human intestinal IELs, where it plays a role in adhesion and may serve as an accessory molecule for IEL activation. CD103 binds to epithelial cell antigen E-cadherin, mediating the homing of lymphocytes to the intestinal epithelium. In peripheral blood and lymphoid organs, CD103 is expressed by 0.5 to 2% of resting lymphocytes, and its expression can be upregulated in vitro by stimulating human T cells with mitogens. CD103 is also expressed by hairy cell leukemia (HCL) and some chronic B cell lymphocytic leukemias. The CD103 antibody stains a few bone marrow cells and, rarely, peripheral blood lymphocytes. Diseases associated with CD103 dysfunction include hairy cell leukemia and splenic marginal zone lymphoma.

Specifications

• Accession Number: P38570
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3682
• Name: Human CD103 (aa 32-163) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A530055J10; alpha-E1; alpha-M290; aM290; antigen CD103; antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide; CD103; DC; DCs; HML-1 antigen; human mucosal lymphocyte antigen 1, alpha polypeptide; HUMINAE; integrin alpha E; integrin alpha E, epithelial-associated; integrin alpha E1, epithelial-associated; integrin alpha M290; Integrin alpha-E; Integrin alpha-E heavy chain; Integrin alpha-E light chain; Integrin alpha-IEL; integrin subunit alpha E; integrin, alpha E; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); integrin, alpha E, epithelial-associated; Intregrin alpha E2; Itgae; MGC141996; Mucosal lymphocyte 1 antigen
• Common Name: CD103 (Integrin alpha E)
• Gene Symbol: Itgae
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining