Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human CD18 Control Fragment Recombinant Protein

Catalog No. RP88639
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88639 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88639 Supplier Invitrogen™ Supplier No. RP88639
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD18, also known as the integrin beta 2 subunit, is a 90-95 kDa type I transmembrane protein expressed on all leukocytes. It heterodimerizes with the alpha chains of CD11a, CD11b, CD11c, and CD11d to form various leukocyte (beta2) integrins, which are crucial for cellular adhesion and signaling. The CD18/CD11a complex, known as lymphocyte function-associated antigen-1 (LFA-1), plays a significant role in cellular adhesion and inflammatory reactions. CD18 also forms heterodimers with CD11b (Mac-1, CR3), CD11c, and CD11d, contributing to the processes of cell adhesion and cell-surface mediated signaling. These integrins are essential for proper leukocyte migration and mediating intercellular contacts. The absence of CD18 leads to leukocyte adhesion deficiency type I (LAD1), a condition characterized by impaired leukocyte migration. Severe reduction in CD18 expression can result in the development of a psoriasiform skin disease. CD18 is also a target of Mannheimia (Pasteurella) haemolytica leukotoxin, which can mediate leukotoxin-induced cytolysis. Defects in the CD18 gene are the cause of LAD1, and two transcript variants encoding the CD18 protein have been identified. The integrin-mediated responses are often a composite of the functions of its individual subunits, highlighting the importance of CD18 in immune function and disease.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P05107
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 3689
Name Human CD18 Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2E6; AI528527; antigen CD18; B-2 integrin; CD18; CD18 leukocyte adhesion molecule; CD18 subunit; cell surface adhesion glycoprotein (LFA-1/CR3/P150,959 beta subunit precursor); cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; complement component 3 receptor 3 and 4 subunit; complement receptor C3 beta-subunit; complement receptor C3 subunit beta; integrin beta 2; integrin beta chain, beta 2; integrin beta-2; integrin subunit beta 2; integrin, beta 2; integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1; integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1; macrophage antigen 1 (mac-1) beta subunit); integrin, beta 2 (antigen CD18 subunit (p95), lymphocyte function-associated antigen 1, integrin B2); integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); ITGB2; LAD; LCAMB; Leu-CAM receptor; leukocyte cell adhesion molecule CD18; leukocyte surface protein; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C; Lfa1; LFA-1; lymphocyte function associated antigen 1; MAC-1; Mac-1 beta; macrophage antigen 1 (mac-1) beta subunit); macrophage antigen-1 beta; MF17; MFI7
Common Name CD18
Gene Symbol ITGB2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.