Invitrogen™ Human CD226 (aa 102-251) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90329	100 μL

Catalog No. RP90329 Supplier Invitrogen™ Supplier No. RP90329

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNAM 1 is a receptor expressed by peripheral blood T lymphocytes that is involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T lymphocytes. DNAM 1 is broadly expressed on T cells, NK cells, platelets, monocytes and a subset of B cells. DNAM-1 is also expressed by a subset of CD3 positive thymocytes.

Specifications

• Accession Number: Q15762
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10666
• Name: Human CD226 (aa 102-251) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: adhesion glycoprotein; BC051526; Cd226; CD226 antigen; CD226 molecule; DNAM 1; DNAM1; DNAM-1; DNAX accessory molecule 1; DNAX accessory molecule-1; platelet and T cell activation antigen 1; platelet and T-cell activation antigen 1; Pta1; T lineage-specific activation antigen 1 antigen; TLiSA1
• Common Name: CD226 (DNAM-1)
• Gene Symbol: Cd226
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining