Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human CD23 (aa 102-181) Control Fragment Recombinant Protein

Catalog No. RP109132
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109132 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109132 Supplier Invitrogen™ Supplier No. RP109132
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD23 is a 45 kDa glycoprotein that serves as a low-affinity receptor for IgE, playing a crucial role in regulating IgE responses and B cell activation. It is expressed on mature B cells, mantle zone B cells, follicular dendritic cells, and at lower levels on T cells, NK cells, Langerhans cells, and platelets. CD23 expression is upregulated upon B cell activation, and its soluble forms are biologically active, acting as potent mitogenic factors. CD23 is strongly expressed on Epstein-Barr virus (EBV)-transformed B lymphoblasts and is present on a subpopulation of freshly isolated peripheral blood and tonsil B cells. It is also detected in neoplastic cells from cases of B cell chronic lymphocytic leukemia and some centroblastic/centrocytic lymphomas. Functionally, CD23 is involved in B cell growth, differentiation, and IgE production. It interacts with CD21 and the alpha subunits of CD11b and CD11c, further influencing immune responses. Diseases associated with CD23 dysfunction include chronic conjunctivitis and chronic lymphocytic leukemia, highlighting its importance in both normal immune function and disease states. This makes CD23 a valuable target for antibody customers interested in B-cell-related research and diagnostics.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P06734
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 2208
Name Human CD23 (aa 102-181) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias BLAST-2; CD23; CD23 antigen; CD23A; CLEC4J; C-type lectin domain family 4 member J; C-type lectin domain family 4, member J; Fc epsilon receptor II; FC epsilon RII; Fc fragment of IgE receptor II; Fc fragment of IgE, low affinity II, receptor for (CD23); Fc receptor alpha multiple ligand receptor; Fc receptor, IgE, low affinity II, alpha polypeptide; Fcalpha muR; Fcalpha RII; Fce2; fc-epsilon-RII; FCER2; Fcer2a; FceRII; IGEBF; Immunoglobulin E-binding factor; immunoglobulin epsilon-chain; low affinity immunoglobulin epsilon Fc receptor; Low affinity immunoglobulin epsilon Fc receptor membrane-bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form; low-affinity IgE receptor; Ly-42; lymphocyte IgE receptor
Common Name CD23
Gene Symbol FCER2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.