Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human CD24 Control Fragment Recombinant Protein

Catalog No. RP108369
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108369 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108369 Supplier Invitrogen™ Supplier No. RP108369
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83798. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD24 is a 35-50 kDa glycosylphosphatidylinositol (GPI)-anchored glycoprotein expressed on a variety of cell types, including erythrocytes, thymocytes, peripheral lymphocytes, and cells of the myeloid lineage. It is variably glycosylated, resulting in heterogeneity in molecular mass across different cell lineages, which can affect antibody staining levels on lymphocyte populations. In the context of B-cell development, CD24 is expressed from the pro-B-cell stage in the bone marrow through to mature, surface Ig-positive B cells, with very low or negative expression on plasma cells. It is also present on the majority of B-lineage acute lymphoblastic leukemias, B-cell chronic lymphocytic leukemias (CCLs), and B-cell non-Hodgkin's lymphomas. CD24 is thought to play a role in regulating B-cell proliferation and maturation, as well as in controlling autoimmunity. Additionally, CD24 has been reported to interact with P-selectin (CD62P), indicating a potential role in cell adhesion and signaling. CD24 is a valuable marker for studying B-cell development, leukemia, lymphoma, and autoimmune regulation, as well as its interactions with other molecules like P-selectin.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P25063
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 100133941
Name Human CD24 Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias CD24; CD24 antigen; CD24 antigen (small cell lung carcinoma cluster 4 antigen); CD24 molecule; CD24A; CD24a antigen; cluster of differentiation 24; FLJ22950; FLJ43543; heat stable antigen; heat-stable antigen; HSA; Ly-52; Lymphocyte antigen 52; M1/69-J11D heat stable antigen; MGC75043; Nectadrin; nectadrin heat stable antigen; R13-Ag; Signal transducer CD24; Small cell lung carcinoma cluster 4 antigen; X62 heat stable antigen
Common Name CD24
Gene Symbol Cd24
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TTGTSSNSSQSTSNSGLAPNPTNATTKVAGGALQSTASLFVVSLSLLHLYS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.