Invitrogen™ Human CD25 (aa 41-115) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103190	100 μL

Catalog No. RP103190 Supplier Invitrogen™ Supplier No. RP103190

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD25 (IL2 receptor alpha chain/IL2RA) is a cytokine that plays a role in the proliferation of T and B lymphocytes. The receptor of this cytokine (IL2RA) is a heterotrimeric protein complex with a gamma chain also shared by interleukin 4 (IL4) and interleukin 7 (IL7). IL2RA, IL2R beta chain (IL2RB), and the IL2R gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric IL2RA chains result in low-affinity receptor, while homodimeric IL2RB chains produce a medium-affinity receptor. The expression of IL2 in mature thymocytes is monoallelic, which represents an unusual regulatory mode for controlling the precise expression of a single gene. IL2 is primarily produced by mature T cells. IL2 plays an important role as a growth factor, differentiation factor, and regulator of cell death. IL-2 stimulates the proliferation of B cells, augments natural killer cell activity, and inhibits granulocyte macrophage colony formation. The targeted disruption of a similar gene in mice leads to ulcerative colitis-like disease, which suggests a role in the immune response to antigenic stimuli. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency.

Specifications

• Accession Number: P01589
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3559
• Name: Human CD25 (aa 41-115) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ADA; ADA1; Adenosine aminohydrolase; adenosine deaminase; CD25; CD25 antigen; cytokine receptor; IDDM10; IL 2 RA; IL 2 receptor; IL 2R; IL 2R subunit alpha; IL2 RA; IL2 RA antibody; IL2 receptor; il-2 receptor alpha; IL-2 Receptor alpha chain; IL-2 receptor alpha subunit; IL2 receptor subunit alpha; IL-2 receptor subunit alpha; IL2R; IL-2R alpha; IL-2R alpha chain; IL2R subunit alpha; IL-2R subunit alpha; Il2ra; IL-2RA; IL-2-RA; IL2-RA; Il2ra antibody; IL2RAC; IMD41; interleukin 2 receptor; interleukin 2 receptor alpha chain; interleukin 2 receptor subunit alpha; interleukin 2 receptor, alpha; interleukin 2 receptor, alpha chain; interleukin-2 receptor alpha; interleukin-2 receptor alpha chain; interleukin-2 receptor alpha subunit; interleukin-2 receptor beta chain; Interleukin2 receptor subunit alpha; interleukin-2 receptor subunit alpha; Ly-43; p55; p55 chain; sIL 2R; soluble IL 2 receptor; TAC antigen; TCGFR
• Common Name: CD25
• Gene Symbol: IL2RA
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining