Invitrogen™ Human CD41 (aa 50-110) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95251	100 μL

Catalog No. RP95251 Supplier Invitrogen™ Supplier No. RP95251

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD41, also known as platelet glycoprotein IIb or ITGA2B, is a protein composed of two subunits: a 120 kDa alpha subunit and a 23 kDa beta subunit. It interacts with CD61 (gpIIIa, integrin beta III) in the presence of calcium to form a functional adhesive protein receptor. Initially thought to be expressed exclusively on platelets and megakaryocytes, CD41 is also found on hematopoietic progenitors in the embryo, fetus, and adult, indicating its role in early stages of hematopoietic differentiation. CD41 plays a crucial role in platelet function and blood coagulation by mediating platelet aggregation. Upon blood vessel damage, CD41 binds to various adhesion molecules, including von Willebrand factor, fibrinogen, fibronectin, and vitronectin, facilitating platelet adhesion and aggregation. This receptor is essential for platelet function, contributing to the binding of several adhesion molecules and playing a significant role in hemostasis. Diseases associated with CD41 dysfunction include Glanzmann Thrombasthenia and Platelet type-16 bleeding disorder, highlighting its importance in normal platelet function and blood coagulation processes.

Specifications

• Accession Number: P08514
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3674
• Name: Human CD41 (aa 50-110) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI172977; alpha IIb; alphaIIb; alphaIIb protein; BDPLT16; BDPLT2; CD41; CD41B; form 1; form 2; GP IIb; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; integrin alpha 2b; integrin alpha 2b (Cd41b); integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin subunit alpha 2b; integrin subunit alpha IIb; integrin, alpha 2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITGA2B; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet glycoprotein IIb of IIb/IIIa complex; platelet membrane glycoprotein IIb; platelet-specific antigen BAK; PPP1R93; protein phosphatase 1, regulatory subunit 93
• Common Name: CD41
• Gene Symbol: Itga2b
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining