Invitrogen™ Human CD42d (aa 179-242) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP109299	100 μL

Catalog No. RP109299 Supplier Invitrogen™ Supplier No. RP109299

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139912. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Natural killer (NK) cells in teleosts and their evolutionary homologue are a subpopulation of lymphocytes with properties that distinguish them from either B- or T-cells. NK cells are important effectors of innate immunity where they release cytokines, which in turn up-regulate other immunological functions. Monoclonal antibodies have been used to identify different surface antigens present on NK cells. These surface antigens have not only been used to identify NK cells, but also their functionally distinct subsets. The Cluster of Differentiation (CD) nomenclature was established to standardize the naming of NK cells.

Specifications

• Accession Number: P40197
• Concentration: 4.00 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2814
• Name: Human CD42d (aa 179-242) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CD42d; Glycoprotein 5; glycoprotein 5 (platelet); glycoprotein 5, platelet; glycoprotein V (platelet); glycoprotein V platelet; GP5; GPV; Platelet glycoprotein 5; platelet glycoprotein V; Platelete glycoprotein 5; Platelets GP V; PLGPV
• Common Name: CD42d
• Gene Symbol: Gp5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GNNLTHLPKGLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining