Invitrogen™ Human CD43 (aa 315-394) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101694	100 μL

Catalog No. RP101694 Supplier Invitrogen™ Supplier No. RP101694

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84247. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD43, also known as leukosialin or sialophorin, is a transmembrane mucin-like protein characterized by a high negative charge. It is expressed on the surface of most hematopoietic cells, excluding resting B lymphocytes. CD43 serves both adhesive and anti-adhesive functions, contributing to a repulsive barrier that can interfere with cellular adhesion while also promoting leukocyte aggregation in certain contexts. CD43 is involved in the activation of T cells, B cells, NK cells, and monocytes. Its expression decreases upon activation due to proteolytic processing. The counter-receptor for CD43 is CD169/SIGLEC-1, which is expressed on macrophages. CD43 interacts with actin-binding proteins ezrin and moesin, playing a regulatory role in remodeling T-cell morphology and regulating cell-cell interactions during lymphocyte traffic. It enhances LFA-1 adhesiveness while counteracting LFA-1 induction via other receptors. CD43 signaling induces the functionally active tumor suppressor p53 protein, but in cases of p53 and ARF deficiency, it can promote tumor proliferation and viability. CD43 is an important modulator of leukocyte functions, with dysfunctions associated with diseases such as Wiscott-Aldrich Syndrome and Adenoid Basal Cell Carcinoma.

Specifications

• Accession Number: P16150
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6693
• Name: Human CD43 (aa 315-394) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 3E8 antigen; A630014B01Rik; B-cell differentiation antigen LP-3; CD43; CD43 cytoplasmic tail; CD43-ct; Galactoglycoprotein; GALGP; gpL115; Leukocyte sialoglycoprotein; leukosialin; leukosianin; LOC101120462; LOW QUALITY PROTEIN: leukosialin; Lsn; Lsn1; Ly48; Ly-48; Lymphocyte antigen 48; sialophorin; sialophorin (gpL115, leukosialin, CD43); sialophorin gpL115; SPN; W3/13 antigen
• Common Name: CD43
• Gene Symbol: SPN
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining