Invitrogen™ Human CD82 (aa 109-216) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102387	100 μL

Catalog No. RP102387 Supplier Invitrogen™ Supplier No. RP102387

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83042. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Specifications

• Accession Number: P27701
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3732
• Name: Human CD82 (aa 109-216) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4F9; AA682076; AL023070; C33; C33 antigen; Cd82; CD82 antigen; CD82 antigen (R2 leukocyte antigen antigen detected by monoclonal and antibody IA4)); CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)); CD82 molecule; GR15; IA4; Inducible membrane protein R2; KAI1; Kangai 1 (suppression of tumerigenicity 6 prostate) CD82 antigen; kangai 1 (suppression of tumorigenicity 6), prostate; kangai 1 (suppression of tumorigenicity 6, prostate); Kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyte antigen, antigen detected by monoclonal and antibody IA4)); metastasis suppressor Kangai-1; Metastasis suppressor Kangai-1 homolog; R2; SAR2; ST6; Suppressor of tumorigenicity 6 protein; Tetraspanin-27; Tspan27; tspan-27
• Common Name: CD82
• Gene Symbol: CD82
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining