Invitrogen™ Human CD94 (aa 40-161) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104109	100 μL

Catalog No. RP104109 Supplier Invitrogen™ Supplier No. RP104109

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64422. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Natural killer (NK) cells, like CD94, are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene.

Specifications

• Accession Number: Q13241
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3824
• Name: Human CD94 (aa 40-161) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Cd94; CD94 antigen; CD94 antigen (located within the rat natural killer gene complex); killer cell lectin like receptor D1; Killer cell lectin-like receptor subfamily D member 1; killer cell lectin-like receptor subfamily D, member 1; killer cell lectin-like receptor, subfamily D, member 1; KLRD1; KP43; natural killer cell receptor; natural killer cells antigen CD94; NK cell receptor
• Common Name: CD94
• Gene Symbol: KLRD1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining