Invitrogen™ Human CD98 (aa 245-385) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90434	100 μL

Catalog No. RP90434 Supplier Invitrogen™ Supplier No. RP90434

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82611. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD98 (4F2) is a type II transmembrane glycoprotein which serves as the heavy chain of the heterodimeric amino acid transporters (HATs). CD98, linked to various light chains by disulfide bond, is responsible for cell surface expression and basolateral localization of this transporter complex in polarized epithelial cells and also interacts with beta1 integrins and increases their affinity for ligand. Besides its roles in amino acid transport, CD98 is thus involved in cell fusion and activation. It is implicated in regulation of cellular differentiation, growth and apoptosis.

Specifications

• Accession Number: P08195
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 6520
• Name: Human CD98 (aa 245-385) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 4F2; 4F2 cell-surface antigen heavy chain; 4F2 heavy chain antigen; 4F2hc; 4T2HC; AI314110; antigen defined by monoclonal antibody 4F2, heavy chain; antigen identified by monoclonal antibodies 4F2; antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43; Cd98; CD98 antigen; CD98 heavy chain; CD98HC; Ly10; Ly-10; Ly-m10; Lymphocyte activation antigen 4F2 large subunit; MDU1; Mgp-2hc; monoclonal antibody 44D7; NACAE; RGD:3073}; SLC3A2; slc3a2 {ECO:0000312; solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2; solute carrier family 3 (amino acid transporter heavy chain), member 2; solute carrier family 3 member 2; solute carrier family 3, member 2; type II transmembrane protein
• Common Name: CD98
• Gene Symbol: SLC3A2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining