Invitrogen™ Human CD99 (aa 143-183) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95420	100 μL

Catalog No. RP95420 Supplier Invitrogen™ Supplier No. RP95420

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111060. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD99 (E2, MIC2) is a transmembrane glycoprotein that is involved in regulation of T cell addhesive properties and programmed cell death distinct from typical apoptosis course. CD99 roles are specific to certain stages of T cell differentiation such as corticothymocytes. CD99R isoform expression is restricted in the haematopoietic system to T, NK and myeloid cells.

Specifications

• Accession Number: P14209
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4267
• Name: Human CD99 (aa 143-183) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110061M03Rik; 12E7; 2410026K10Rik; antigen identified by monoclonal 12E7, Y homolog; antigen identified by monoclonal antibodies 12E7, F21 and O13; Cd99; CD99 antigen; CD99 molecule; cell surface antigen 12E7; cell surface antigen HBA-71; cell surface antigen O13; D4; E2 antigen; HBA71; MIC2; MIC2 (monoclonal antibody 12E7); MIC2X; MIC2Y; MSK5X; paired immunoglobin-like type 2 receptor-ligand; pilr-1; Pilrl; PILR-L; Protein MIC2; surface antigen MIC2; T-cell surface glycoprotein E2
• Common Name: CD99
• Gene Symbol: CD99
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining