Invitrogen™ Human CDK1 (aa 176-297) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102060	100 μL

Catalog No. RP102060 Supplier Invitrogen™ Supplier No. RP102060

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82086. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDK1 or Cell Division Control protein 1 is essential for the completion of START, the controlling event in the cell cycle that is required to initiate mitosis. CDK1 is a catalytic subunit of a protein kinase complex, called the M-Phase Promoting Factor that induces entry into mitosis and is universal among eukaryotes. Phosphorylation of Bcl-2 in G2/M phase-arrested cells following photodynamic therapy with hypericin involves a CDK1-mediated signal and delays the onset of apoptosis. Therapeutic potential of CDK inhibitor NU2058 in androgen-independent prostate cancer has also been demonstrated.

Specifications

• Accession Number: P06493
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 983
• Name: Human CDK1 (aa 176-297) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5363; ABL1; cdc; CDC2; cdc-2; cdc2 kinase; CDC28A; Cdc2a; cdc2-a; cdc2Dm; cdc2x1.1; CDCDm; CDK1; Cdk-1; cdk1.S; CDK1/CDC2; CDK1-A; cdk1-b; Cdk1-PA; CDKN1; cell cycle controller CDC2; cell cycle p34 CDC2 kinase protein; cell division control; cell division control protein 2 homolog; Cell division control protein 2 homolog 1; cell division control protein 2-A; cell division cycle 2 homolog A; cell division cycle 2 like; cell division cycle 2, G1 to S and G2 to M; Cell division cycle control protein 2; cell division cycle control protein 2a; cell division protein kinase 1; Cell division protein kinase 1-A; CG5363; CG5363-PA; cyclin dependent kinase; cyclin dependent kinase 1; cyclin-dependent kinase; Cyclin-dependent kinase 1; cyclin-dependent kinase 1 S homeolog; cyclin-dependent kinase 1-A; D2366; Dcdc2; dCdk1; DKFZp686L20222; Dm cdc2; Dmcdc2; DmCdk1; Dmel\CG5363; Dmel_CG5363; DNA polymerase delta catalytic subunit; DNA polymerase III; DNA-directed DNA polymerase delta POL3; group 4; HPR6; KCIP-1; l(2)31Eh; LD38718p; maturation-promoting factor; MGC111195; MGC53829; MPF; OTTHUMP00000019660; P34 CDK1; P34 MGC111195; p34 protein kinase; p34 protein kinase 1; p34>CDC2>; p34cdc2; p34-cdc2 homologue; POL3; Protein 1054; protein 2; PSTAIR; TEX1; unnamed protein product; xcdc2; XELAEV_18036802mg; YDL102W
• Common Name: CDK1
• Gene Symbol: CDK1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining