Invitrogen™ Human CDK5RAP3 (aa 408-506) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93195	100 μL

Catalog No. RP93195 Supplier Invitrogen™ Supplier No. RP93195

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54569. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, May 2013].

Specifications

• Accession Number: Q96JB5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80279
• Name: Human CDK5RAP3 (aa 408-506) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1810007E24Rik; BC002318; C53; C81486; CDK5 activator-binding protein C53; CDK5 activator-binding protein C53; CDK5 regulatory subunit associated protein 3; CDK5 regulatory subunit associated protein IC53-2; CDK5 regulatory subunit-associated protein 3; Cdk5rap3; HSF-27; IC53; IC53-2; ischemic heart CDK5 activator-binding protein C53; LXXLL/leucine-zipper-containing ARFbinding protein; LXXLL/leucine-zipper-containing ARF-binding protein; LZAP; MST016; MSTP016; OK/SW-cl.114; PP1553; Protein HSF-27
• Common Name: CDK5RAP3
• Gene Symbol: CDK5RAP3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining