Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human CDK8 (aa 359-451) Control Fragment Recombinant Protein

Catalog No. RP104796
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104796 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104796 Supplier Invitrogen™ Supplier No. RP104796
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65388. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDK8 phosphorylates the carboxy-terminal domain of the largest subunit of RNA polymerase II. This protein is coexpressed and copurified with Cyclin C. CDK8 is part of a family of proteins designated as cdks are critical regulators of cell cycle progression. The prototype member of this family, p34/Cdc 2, and a related protein Cdk 2, function late in the cycle while Cdk 4 and Cdk 6 are critically involved in G1 to S progression. Because of analogy with yeast Cdk 8, it has been proposed that the human Cdk 8 Cyclin C may interact with RNA polymerase, thus influencing the transcription mechanism(s) that lead to cell division.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49336
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 1024
Name Human CDK8 (aa 359-451) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias Cdk8; CDK8 protein kinase; cell division protein kinase 8; Cell division protein kinase 8-like protein; cyclin dependent kinase 8; cyclin-dependent kinase 8; K35; mediator complex subunit CDK8; Mediator of RNA polymerase II transcription subunit CDK8; MGC126074; MGC126075; protein kinase K35; RGD1560888; wu:fk95h11
Common Name CDK8
Gene Symbol Cdk8
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.