Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99873

Invitrogen™ Human CENPV (aa 108-182) Control Fragment Recombinant Protein

Catalog No. RP99873
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99873 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99873 Supplier Invitrogen™ Supplier No. RP99873
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60049. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CENPV orthologs were detected in a range of species, including plants, but the proline-rich region was detected only in primates, rodents, birds, and amphibians, and long proline stretches were found only in primates. Northern blot analysis showed ubiquitous Cenpv expression in mouse tissues, with highest expression in testis, followed by small intestine, brain, and kidney. Immunofluorescence microscopy of mouse fibroblasts revealed colocalization of Cenpv with stabilized cytoplasmic microtubules. Western blot analysis of Ramos B cells detectedCENPV at an apparent molecular mass of 40 kD.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z7K6
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 201161
Name Human CENPV (aa 108-182) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 3110013H01Rik; AA671303; Cenpv; CENP-V; Centromere protein V; nuclear protein p30; p30; proline rich 6; proline-rich polypeptide 6; proline-rich protein 6; Prr6; RGD1565681
Common Name CENPV
Gene Symbol CENPV
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.