Invitrogen™ Human CENTB1 (aa 205-274) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107134	100 μL

Catalog No. RP107134 Supplier Invitrogen™ Supplier No. RP107134

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84987. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACAP1, also known as Centaurin-beta-1 (CENTB1), is a 740 amino acid containing transport carrier belonging to the Centaurin family with three ANK repeats, an Arf-GAP domain, a BAR domain and a PH domain that binds to phospholipids. ACAP1, a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6), is required for clathrin-dependent export of proteins from recycling endosomes to trans-Golgi network and cell surface. It mediates CENTB1-binding to phosphatidylinositol 3,5-bisphosphate (PIP2) or phosphatidylinositol 3,4,5-trisphosphate (PIP3) containing membranes. Along with ACAP2, ACAP1 is recruited to platelet-derived growth factor (PDGF) induced dorsal membrane ruffles in NIH 3T3 mouse fibroblasts, while over expression inhibited ruffle formation. It is widely expressed in most tissues with high expression in lung and spleen and low expression in heart, kidney, liver and pancreas.

Specifications

• Accession Number: Q15027
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9744
• Name: Human CENTB1 (aa 205-274) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Acap1; Arf GAP with coiled coil, ANK repeat and PH domains 1; arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1; ArfGAP with coiled-coil, ankyrin repeat and PH domains 1; centaurin beta 1; centaurin, beta 1; centaurin-beta-1; Centb1; cnt-b1; KIAA0050
• Common Name: CENTB1
• Gene Symbol: ACAP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining