Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CEP112 Full-length ORF (NP_001032402.1, 1 a.a. - 211 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89939262 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
10 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-939-262 25 μg
89-939-261 10 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. 89-939-262 Supplier Abnova™ Supplier No. H00201134P01L
Only null left
Add to Cart
Add to Cart

Used for AP, Array, ELISA, WB-Re

This gene encodes a protein with filament, myosin tail and ATPase domains. Orthologs of this gene exist in mouse, rat and chimp. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Sequence: MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGRR

Specifications

Accession Number NP_001032402.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 201134
Molecular Weight (g/mol) 50.9kDa
Name CEP112 (Human) Recombinant Protein (P01)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 μg
Immunogen MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRCAEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGRR
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CCDC46/MACOCO
Common Name CEP112
Gene Symbol CEP112
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.