Invitrogen™ Human CEP164 (aa 381-478) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP97298	100 μL

Catalog No. RP97298 Supplier Invitrogen™ Supplier No. RP97298

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58034. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CEP164 was initially identified as a centrosomal protein, but other studies have indicated that it also plays a role in the formation of primary cilia, the microtubule-based sensory antennae projecting from the surface of many eukaryotic cells as well as in DNA damage response acting as a mediator protein. CEP164 interacts with both ATR and ATM, proteins that trigger a number of cellular responses including the initiation of DNA damaged-induced cell cycle checkpoints. It is phosphorylated upon replication stress, ultraviolet (UV) radiation, and ionizing radiation silencing of CEP164 significantly reduces the DNA damage-induced phosphorylation of several proteins in the DNA damage-activated signaling cascade and compromises cell survival after UV damage. At least two isoforms of CEP164 are known to exist.

Specifications

• Accession Number: Q9UPV0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 22897
• Name: Human CEP164 (aa 381-478) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI450905; BC027092; ce164; centrosomal protein 164; centrosomal protein 164kDa; centrosomal protein of 164 kDa; Cep 164; CEP164; D030051D21; KIAA1052; mKIAA1052; NPHP15; RGD1560988; RGD1561243
• Common Name: CEP164
• Gene Symbol: CEP164
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining