Invitrogen™ Human CEP57 (aa 118-226) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91857	100 μL

Catalog No. RP91857 Supplier Invitrogen™ Supplier No. RP91857

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53777. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Translokin binds basic fibroblast growth factor (FGF2; MIM 134920) and mediates its nuclear translocation and mitogenic activity (Bossard et al., 2003 [PubMed 12717444]).

Specifications

• Accession Number: Q86XR8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9702
• Name: Human CEP57 (aa 118-226) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 3110002L15Rik; 4921510P06Rik; 4931428M20Rik; AI467480; centrosomal protein 57; centrosomal protein 57kDa; centrosomal protein of 57 kDa; Cep57; FGF2-interacting protein; KIAA0092; mKIAA0092; MVA2; PIG8; proliferation-inducing protein 8; RGD1309884; testis-specific protein 57; Translokin; Tsp57
• Common Name: CEP57
• Gene Symbol: CEP57
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining