Invitrogen™ Human cGKII (aa 47-182) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102027	100 μL

Catalog No. RP102027 Supplier Invitrogen™ Supplier No. RP102027

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52426. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PRKG2 (PKG2, cGKII) exhibits many cellular functions and has cAMP- and cGMP-dependent protein kinase activity. cGKII is thought to play a key role in a diverse set of physiological pathway. cGKII may mediate intestinal secretion of water and electrolytes induced by the E. coli toxin STa and the intestinal peptide guanylin. Identification of the pathway that mediates intestinal fluid secretion by E. coli. cGKII is postulated to be a molecular switch that couples the cessation of proliferation and the start of hypertrophic chondrocyte differentiation through attenuating SOX9 function.

Specifications

• Accession Number: Q13237
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 5593
• Name: Human cGKII (aa 47-182) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW212535; cGK 2; cGK2; cGKII; cGK-II; cGMP dependent protein kinase type II; cGMP-dependent protein kinase 2; cGMP-dependent protein kinase II; EC 2.7.11.12; GDPKII; PRKG2; PRKGR2; protein kinase cGMP- dependent type 2; protein kinase, cGMP- dependent, type 2; protein kinase, cGMP- dependent, type II; protein kinase, cGMP-dependent, type II; testicular tissue protein Li 99; type II cGMP-dependent protein kinase
• Common Name: cGKII
• Gene Symbol: PRKG2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: REYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining