Invitrogen™ Human ChAT (aa 275-374) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102375	100 μL

Catalog No. RP102375 Supplier Invitrogen™ Supplier No. RP102375

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ChAT catalyzes the reversible synthesis of acetylcholine (ACh) from acetyl CoA and choline at cholinergic synapses.

Specifications

• Accession Number: P28329
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1103
• Name: Human ChAT (aa 275-374) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: acetyl CoA; acetyl CoA:choline O-acetyltransferase; B230380D24Rik; CHAT; CHOACTASE; choline acetylase; choline acetyltransferase; choline acetyltransferase (EC 2.3.1.6); choline acetyltransferase long variant; choline acetyltransferase short variant; choline O-acetyltransferase; CMS1A; CMS1A2; CMS6; LOW QUALITY PROTEIN: choline O-acetyltransferase; N-type choline acetyltransferase
• Common Name: ChAT
• Gene Symbol: CHAT
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining