Invitrogen™ Human CHD2 (aa 1331-1422) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101494	100 μL

Catalog No. RP101494 Supplier Invitrogen™ Supplier No. RP101494

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CHD family of proteins is characterized by the presence of chromo domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Specifications

• Accession Number: O14647
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1106
• Name: Human CHD2 (aa 1331-1422) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2810013C04Rik; 2810040A01Rik; 5630401D06Rik; AI851092; ATP-dependent helicase CHD2; BC029703; chd2; CHD-2; chromodomain helicase DNA binding protein 2; chromodomain-helicase-DNA-binding protein 2; DKFZp547I1315; DKFZp686E01200; DKFZp781D1727; Down syndrome cell adhesion molecule; EEOC; FLJ38614; LOW QUALITY PROTEIN: chromodomain-helicase-DNA-binding protein 2; si:ch211-196l7.5
• Common Name: CHD2
• Gene Symbol: CHD2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTGGEEAKLKKRKPRVKKENKVPRLKEEHGIELSSPRHSDNPSEEGEVKDDGLEKSPMKKKQKKKENKENKEKQMSSRKDKEGDKERKKSKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining