Invitrogen™ Human CHD9 (aa 392-505) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98770	100 μL

Catalog No. RP98770 Supplier Invitrogen™ Supplier No. RP98770

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59845. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHD9 (chromodomain-helicase-DNA-binding protein 9), also known as chromatin-related mesenchymal modulator (CReMM), PPAR-α-interacting complex protein, kismet homolog 2 or CHROM1, is a 2,897 amino acid protein belonging to the Snf2/Rad54 helicase family. The CHD family of proteins are ATP-dependent chromatin remodeling enzymes which combine chromodomains with SWI2/Snf2 ATPase/helicase motifs and DNA-binding capability. Localized to the cytoplasm and the nucleus, CHD9 contains two chromodomains, one ATPbinding helicase domain and one C-terminal helicase domain. Chromodomains are protein regions of about 40-50 amino acid residues found in proteins associated with chromatin remodeling and manipulation. The domain is highly conserved among both plants and animals and is found in a large variety of proteins from many genomes. CHD9 acts as a transcriptional coactivator for PPARα and may also be an ATP-dependent chromatin remodeling protein. CHD9 is widely expressed at low levels and is present as three isoforms produced by alternative splicing.

Specifications

• Accession Number: Q3L8U1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80205
• Name: Human CHD9 (aa 392-505) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1810014J18Rik; 9030205D12Rik; A330063D19Rik; AD013; AD-013; ATP-dependent helicase CHD9; BC022889; Chd9; CHD-9; chromatin remodeling factor CHROM1; chromatin-related mesenchymal modulator; Chromatin-remodeling factor CHROM1; chromodomain helicase DNA binding protein 9; chromodomain-helicase-DNA-binding protein 9; ciprofibrate bound protein p240; ciprofibrate-bound protein PRIC320; CReMM; FLJ12178; Kiaa0308; KISH2; Kismet homolog 2; mKIAA0308; peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein; PPAR{gamma}-interacting cofactor 320 kDa; PPAR-alpha-interacting complex protein 320 kDa; PRIC320; proteinx0008; x0008
• Common Name: CHD9
• Gene Symbol: Chd9
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HQVESQTEPFTGLDPEDLLQEGLLPHFDESTFGQDNSSHILDHDLDRQFTSHLVTRPSDMAQTQLQSQARSWHSSFSNHQHLHDRNHLCLQRQPPSSKKSDGSGTYTKLQNTQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining