Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96292

Invitrogen™ Human CHMP2B (aa 49-116) Control Fragment Recombinant Protein

Catalog No. RP96292
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96292 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96292 Supplier Invitrogen™ Supplier No. RP96292
  • $283.00
    $212.65 / Each of 1

    Save $70.35

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

missing translation for 'validMainframeMsg'

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHMP2B, also known as CHMP2.5 or vacuolar protein-sorting-associated protein 2-2, is a 213 amino acid cytosolic protein. Widely expressed in brain, heart, skeletal muscle, small intestine, pancreas, lung, placenta and leukocytes, CHMP2B associates directly with CHMP2A and vps4 for the disassembly of the ESCRT-III complex. Defects in the gene encoding CHMP2B have been shown to cause chromosome 3-linked frontotemporal dementia (FTD3).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UQN3
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 25978
Name Human CHMP2B (aa 49-116) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1190006E07Rik; ALS17; CGI-84; Charged multivesicular body protein 2b; charged multivesicular body protein 2Bb; CHMP family; CHMP2.5; CHMP2B; chmp2bb; chmp2bl; chromatin modifying protein 2B; chromatin modifying protein 2B, like; chromatin modifying protein 2Bb; chromatin-modifying protein 2b; DMT1; hVps2-2; hypothetical protein LOC615954; hypothetical protein zgc:77025; RGD1306781; si:ch211-106g5.3; Vacuolar protein sorting-associated protein 2-2; vacuolar protein-sorting-associated protein 2-2; VPS2 homolog B; VPS2-2; VPS2B; zgc:77025
Common Name CHMP2B
Gene Symbol Chmp2b
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.