Invitrogen™ Human CHST7 (aa 133-276) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92335	100 μL

Catalog No. RP92335 Supplier Invitrogen™ Supplier No. RP92335

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-52023, PA5-140054. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the sulfotransferase gene family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This gene product mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of this gene family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes. This gene is part of a gene cluster on chromosome Xp11.23.

Specifications

• Accession Number: Q9NS84
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 56548
• Name: Human CHST7 (aa 133-276) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2600013M07Rik; C6ST-2; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7; carbohydrate (N-acetylglucosamino) sulfotransferase 7; carbohydrate sulfotransferase 7; Chondroitin 6-sulfotransferase 2; chondroitin 6-sulfotransferase 7; chondroitin 6-sulfotransferase-2; CHST7; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 5; glcNAc6ST-4; Gn6st-4; Gst5; GST-5; mC6ST-2; N-acetylglucosamine 6-O-sulfotransferase 1; N-acetylglucosamine 6-O-sulfotransferase 4
• Common Name: CHST7
• Gene Symbol: CHST7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTACERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining