Invitrogen™ Human CIDEC (aa 1-69) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP92097	100 μL

Catalog No. RP92097 Supplier Invitrogen™ Supplier No. RP92097

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110844 (PA5-110844. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA fragmentation is one of the critical steps in apoptosis, which is induced by DNA fragmentation factor (DFF). DFF is composed of two subunits, a 40 kDa caspase-activated nuclease (DFF40) and a 45 kDa inhibitor (DFF45). Recently a novel family of cell-death-inducing DFF45-like effectors (CIDEs) has been identified. Human CIDE-3 is a novel member of CIDEs. There are 2 transcripts, CIDE-3 and CIDE-3alpha, were present in HepG2 and A375 cells. Consistent with its chromosome localization at 3p25, a region associated with high frequency loss of heterozygosity in many tumours, CIDE-3 may play an important role in prevention of tumorigenesis.

Specifications

• Accession Number: Q96AQ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63924
• Name: Human CIDEC (aa 1-69) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cell death activator CIDE-3; cell death inducing DFFA like effector c; cell death-inducing DFFA-like effector c; cell death-inducing DFFA-like effector protein C; CID; cide 3; CIDE3; CIDE-3; CIDE-3 alpha; Cidec; fat specific gene 27; fat specific protein 27; fat-specific protein FSP27; Fat-specific protein FSP27 homolog; FPLD5; FSP27
• Common Name: CIDEC
• Gene Symbol: CIDEC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining