Invitrogen™ Human CISD2 (aa 61-135) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90311	100 μL

Catalog No. RP90311 Supplier Invitrogen™ Supplier No. RP90311

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53398. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Defects in the CISD2 (CDGSH iron sulfur domain 2) gene are a cause of the neurodegenerative disorder Wolfram syndrome 2. CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum and mitochondria and binds an iron/sulfur cluster. CISD2 interacts with Bcl-2 and can be displaced by the BH3-only protein BIK and contributes to the regulation of BIK-initiated autophagy. CISD2 deficiency in mice causes mitochondrial breakdown accompanied by autophagic cell death as well as the development of premature aging phenotype.

Specifications

• Accession Number: Q8N5K1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 493856
• Name: Human CISD2 (aa 61-135) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1500009M05Rik; 1500026J14Rik; 1500031D15Rik; AI848398; B630006A20Rik; BcDNA:RE49709; CDGSH iron sulfur domain 2; CDGSH iron sulfur domain-containing protein 2; CDGSH iron-sulfur domain-containing protein 2; CDGSH iron-sulfur domain-containing protein 2 homolog; Cdgsh2; CG1458; CG1458-PA; cisd2; Cisd2-PA; dkey-162b23.1; Dmel\CG1458; Dmel_CG1458; dWFS2; endoplasmic reticulum intermembrane small protein; ERIS; Miner1; MitoNEET; mitoNEET related 1; mitoNEET-related 1 protein; NAF-1; nervous system overexpressed protein 70; nervous system over-expressed protein 70; Noxp70; Nutrient-deprivation autophagy factor-1; RE49709p; RGD1566242; RH38554p; WFS2; Zcd2; zgc:64148; zgc:64148 protein; zinc finger, CDGSH-type domain 2; zKM0001
• Common Name: CISD2
• Gene Symbol: CISD2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining