Invitrogen™ Human CLCNKA (aa 525-559) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104514	100 μL

Catalog No. RP104514 Supplier Invitrogen™ Supplier No. RP104514

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63472. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CLC-KA is a kidney-specific chloride channel that mediates transepithelial chloride transport in the thin ascending limb of the Henle loop in the inner medulla. CLC-KA plays a crucial role in urine concentration. The gene encoding human CLC-KA maps to chromosome 1p36. Mutations in this gene may be associated with nephrogenic diabetes insipidus in those cases where mutations in the vasopressin V2 receptor and the AQP2 water channel are lacking. CLC-KB mediates basolateral chloride ion efflux in the thick ascending limb and in more distal nephron segments. The gene encoding human CLC-KB maps to chromosome 1p36. Mutations in this gene cause type III Barter's syndrome which is characterized by renal salt-wasting and low blood pressure.

Specifications

• Accession Number: P51800
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 1187
• Name: Human CLCNKA (aa 525-559) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C75963; chloride channel K1; chloride channel Ka; Chloride channel protein ClC-Ka; chloride channel, kidney, A; chloride channel, voltage-sensitive Ka; chloride voltage-gated channel Ka; CLCK1; clC-K1; CLCKA; CLC-KA; Clcnk1; Clcnka; hClC-Ka; putative basolateral cTAL chloride channel ClC-Ka
• Common Name: CLCNKA
• Gene Symbol: CLCNKA
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining