Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human CNDP2 (aa 154-249) Control Fragment Recombinant Protein

Catalog No. RP102753
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102753 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102753 Supplier Invitrogen™ Supplier No. RP102753
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83358. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CNDP2 gene encodes the protein carnosine dipeptidase 2, which belongs to the M20 metallopeptidase family and plays a critical role in the metabolism of dipeptides. CNDP2 is primarily involved in the hydrolysis of carnosine, a dipeptide composed of beta-alanine and histidine, and is expressed in various tissues, including the liver and kidney. This enzyme is significant in cellular processes related to nitrogen metabolism and the regulation of histidine-containing dipeptides, which have antioxidant properties influencing cellular redox balance. CNDP2 has implications in renal function and disease, where altered activity can impact the concentration of bioactive peptides involved in protective mechanisms against oxidative stress. Additionally, CNDP2 may have roles in metabolic diseases, such as diabetes and hypertension, where dipeptide regulation can influence metabolic pathways and cellular protection mechanisms. Ongoing research explores CNDP2's enzymatic activity, regulation, and potential therapeutic applications, particularly in conditions where modulation of peptide metabolism can offer clinical benefits.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96KP4
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 55748
Name Human CNDP2 (aa 154-249) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 0610010E05Rik; C76600; carnosine dipeptidase 2; carnosine dipeptidase II; CN2; CNDP dipeptidase 2; CNDP dipeptidase 2 (metallopeptidase M20 family); Cndp2; CPGL; cytosolic nonspecific dipeptidase; Cytosolic non-specific dipeptidase; cytosolic nonspecific dipeptidase 2; Dip-2; Epididymis secretory protein Li 13; glutamate carboxypeptidase-like protein 1; HEL-S-13; HsT2298; Pep1; Pep-1; PEPA; peptidase 1; peptidase A; wu:fd20d11; wu:fe17f09; zgc:92569
Common Name CNDP2
Gene Symbol Cndp2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.