Invitrogen™ Human CNDP2 (aa 23-96) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102752	100 μL

Catalog No. RP102752 Supplier Invitrogen™ Supplier No. RP102752

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83357. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CNDP2 gene encodes the protein carnosine dipeptidase 2, which belongs to the M20 metallopeptidase family and plays a critical role in the metabolism of dipeptides. CNDP2 is primarily involved in the hydrolysis of carnosine, a dipeptide composed of beta-alanine and histidine, and is expressed in various tissues, including the liver and kidney. This enzyme is significant in cellular processes related to nitrogen metabolism and the regulation of histidine-containing dipeptides, which have antioxidant properties influencing cellular redox balance. CNDP2 has implications in renal function and disease, where altered activity can impact the concentration of bioactive peptides involved in protective mechanisms against oxidative stress. Additionally, CNDP2 may have roles in metabolic diseases, such as diabetes and hypertension, where dipeptide regulation can influence metabolic pathways and cellular protection mechanisms. Ongoing research explores CNDP2's enzymatic activity, regulation, and potential therapeutic applications, particularly in conditions where modulation of peptide metabolism can offer clinical benefits.

Specifications

• Accession Number: Q96KP4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55748
• Name: Human CNDP2 (aa 23-96) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610010E05Rik; C76600; carnosine dipeptidase 2; carnosine dipeptidase II; CN2; CNDP dipeptidase 2; CNDP dipeptidase 2 (metallopeptidase M20 family); Cndp2; CPGL; cytosolic nonspecific dipeptidase; Cytosolic non-specific dipeptidase; cytosolic nonspecific dipeptidase 2; Dip-2; Epididymis secretory protein Li 13; glutamate carboxypeptidase-like protein 1; HEL-S-13; HsT2298; Pep1; Pep-1; PEPA; peptidase 1; peptidase A; wu:fd20d11; wu:fe17f09; zgc:92569
• Common Name: CNDP2
• Gene Symbol: Cndp2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining