Invitrogen™ Human CNTROB (aa 647-726) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93415	100 μL

Catalog No. RP93415 Supplier Invitrogen™ Supplier No. RP93415

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54761. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CNTROB is a centrosomal protein that interacts with BRCA2 and is required for centriole duplication and cytokinesis (Zou et al., 2005 ).

Specifications

• Accession Number: Q8N137
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 116840
• Name: Human CNTROB (aa 647-726) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9830165K03Rik; centrobin; centrobin, centriole duplication and spindle assembly protein; centrobin, centrosomal BRCA2 interacting protein; centrosomal BRCA2-interacting protein; CNTROB; LIP8; LYST-interacting protein 8; LYST-interacting protein LIP8; PP1221; RGD1307488
• Common Name: CNTROB
• Gene Symbol: CNTROB
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SQHSFQPLEPKPDLTSSTAGAFSALGAFHPDHRAERPFPEEDPGPDGEGLLKQGLPPAQLEGLKNFLHQLLETVPQNNEN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining