Invitrogen™ Human Complement C3 (aa 1259-1401) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110671 (PA5-110671. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C3 is a key component of the complement system since classical and alternative activation pathways merge at the C3 activation step when C3 is split into C3a and C3b. The molecular mass of C3 is 185 kDa and it consists of two chains (110 kDa and 75 kDa) held together by disulfide bonds.

Specifications

• Accession Number: P01024
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 718
• Name: Human Complement C3 (aa 1259-1401) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Acylation stimulating protein; acylation-stimulating protein cleavage product; AHUS5; AI255234; ARMD9; ASP; C3; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3a; C3a anaphylatoxin; C3adesArg; C3b; C3bc; C3-beta-c; C3d; complement C3; Complement C3 alpha chain; Complement C3 beta chain; complement C3 protein (GPC3) precursor; Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3c alpha' chain fragment 2; Complement C3d fragment; Complement C3dg fragment; Complement C3f fragment; Complement C3g fragment; complement component 3; complement component C3; complement component C3 alpha-chain; complement component C3a; complement component C3b; complement component C3d; CPAMD1; ENCF-1; ENCF-2; epididymis secretory sperm binding protein Li 62 p; HEL-S-62 p; HSE-MSF; I79_008227; LOC100060539; Neutrophil chemotactic factor-1; Neutrophil chemotactic factor-2; Plp; prepro-C3; Unknown (protein for MGC:134562)
• Common Name: Complement C3
• Gene Symbol: C3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining