Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human Complement Factor B (aa 203-349) Control Fragment Recombinant Protein

Catalog No. RP100396
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100396 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100396 Supplier Invitrogen™ Supplier No. RP100396
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Factor B is a component of the alternative complement pathway. The protein is a single chain polypeptide with a molecular mass of 93 kDa. Factor B is cleaved by factor D into the Ba component (30 kDa) and the Bb (63 kDa). Bb together with C3b forms the alternative pathway C3 convertase C3bBb.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P00751
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 629
Name Human Complement Factor B (aa 203-349) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AHUS4; AI195813; AI255840; alternative-complement pathway C3/C5 convertase; ARMD14; B; BF; B-factor, properdin; BFD; C2; C3 proaccelerator; C3 proactivator; C3/C5 convertase; CFAB; CFB; CFBD; complement component 2 (within H-2S); complement factor B; Complement factor B Ba fragment; Complement factor B Bb fragment; Da1-24; DADB-122G4.5; Factor B; Fb; FBI12; GBG; glycine-rich beta glycoprotein; glycine-rich beta-glycoprotein; H2-Bf; histocompatibility 2, complement component factor B; PBF2; properdin; properdin factor B
Common Name Complement Factor B
Gene Symbol CFB
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.