Invitrogen™ Human Connexin 46 (aa 102-143) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105732	100 μL

Catalog No. RP105732 Supplier Invitrogen™ Supplier No. RP105732

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64957. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Connexin 46 (Cx46), also known as Gap Junction Protein Alpha-3 (GJA3), CAE3, CX46 and C2P3, maps to human chromosome 13q11-q12 and encodes a 46 kDa protein. Cx46, along with Cx50, is principally expressed in the lens of the eye. Cx46 mediates intercellular interactions during development and is necessary for the survival of neural crest cells. Cx46 forms gap junctions that connect lens fiber cells and are crucial for maintaining lens transparency and normal lens function. Mutations of Cx46 result in severe cataracts of the lens. Individual knockouts of Cx46 and Cx50 lead to changes in the rate of lens fiber cell differentiation and cell size, thus the interaction of Cx46 and Cx50 is required for proper organization of fiber cells.

Specifications

• Accession Number: Q9Y6H8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2700
• Name: Human Connexin 46 (aa 102-143) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: alpha 3 connexin; Cnx46; connexin 46; connexin-46; CTRCT14; Cx43; CX46; Cxn-46; CZP3; gap junction alpha 3; gap junction alpha-3 protein; gap junction membrane channel protein alpha 3; gap junction protein alpha 3; gap junction protein, alpha 3; gap junction protein, alpha 3, 46kDa; Gja3; Gja-3
• Common Name: Connexin 46
• Gene Symbol: GJA3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining