Invitrogen™ Human COQ10B (aa 3-76) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96025	100 μL

Catalog No. RP96025 Supplier Invitrogen™ Supplier No. RP96025

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61138. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

COQ10B, Coenzyme Q10, is a 247 amino acid protein encoded by the human gene COQ10B. COQ10B is a mitochondrial protein that belongs to the COQ10 family. COQ10B is an essential biological cofactor which increases brain mitochondrial concentration and exerts neuroprotective effects. Plasma COQ10B levels decrease in patients with advanced chronic heart failure (CHF) while COQ10B levels in hyperthyroid patients are found among the lowest detected in human diseases. Likewise, COQ10B is elevated in hypothyroid subjects, also in subclinical conditions, suggesting the usefulness of this index in assessing metabolic status in thyroid disorders. It is believed that secretion of adrenal hormones is in some way related to COQ10B levels, both in augmented and reduced conditions. However, since thyroid hormones have an important role in modulating COQ10B levels and metabolism, when coexistent, thyroid deficiency seems to play a prevalent role in comparison with adrenal deficiency.

Specifications

• Accession Number: Q9H8M1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80219
• Name: Human COQ10B (aa 3-76) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1500041J02Rik; 1700030I21Rik; 9530077A17Rik; AV002237; AW742641; coenzyme Q10 homolog B; coenzyme Q10 homolog B (S. cerevisiae); coenzyme Q10B; coenzyme Q-binding protein COQ10 homolog B, mitochondrial; COQ10B; RGD1359509
• Common Name: COQ10B
• Gene Symbol: COQ10B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining