Invitrogen™ Human CPAMD8 (aa 747-845) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102590	100 μL

Catalog No. RP102590 Supplier Invitrogen™ Supplier No. RP102590

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56706. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The CPAMD8 gene, known as C3 and pregnancy zone protein-like alpha-2-macroglobulin domain-containing 8, is involved in the development of ocular tissues. It has been linked to anterior segment dysgenesis (ASD) and congenital glaucoma, indicating its critical role in eye development. CPAMD8 functions primarily within the non-pigmented epithelium and might participate in cellular communication and structural integrity during the differentiation of retinal organoids. Loss-of-function mutations in CPAMD8 disrupt normal eye formation, leading to various ocular disorders. Recent advancements, such as the establishment of CPAMD8-GFP reporter human embryonic stem cell lines, enable real-time monitoring of its expression, thereby facilitating exploration of its biological functions in retinal differentiation processes. Bioinformatic evaluations and CRISPR/Cas9 technology have provided insights into CPAMD8's role in eye development, with gene editing approaches helping delineate its involvement in ocular health and disease.

Specifications

• Accession Number: Q8IZJ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 27151
• Name: Human CPAMD8 (aa 747-845) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: alpha-2 macroglobulin family protein VIP; C3 and PZP like, alpha-2-macroglobulin domain containing 8; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 8; C3 and PZP-like, alpha-2-macroglobulin domain containing 8; CPAMD8; K-CAP; VIP
• Common Name: CPAMD8
• Gene Symbol: CPAMD8
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FPETWIWHCLNISDPSGEGTLSVKVPDSITSWVGEAVALSTSQGLGIAEPSLLKTFKPFFVDFMLPALIIRGEQVKIPLSVYNYMGTCAEVYMKLSVPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining