Invitrogen™ Human CR16 (aa 387-446) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98475	100 μL

Catalog No. RP98475 Supplier Invitrogen™ Supplier No. RP98475

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59481. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be a regulator of cytoskeletal organization. May have a role in spermatogenesis. Target protein binds SH3 domains; may play a role in MAP kinase mediated signal transduction.

Specifications

• Accession Number: A6NGB9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 644150
• Name: Human CR16 (aa 387-446) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: corticosteroids and regional expression protein 16; Corticosteroids and regional expression protein 16 homolog; CR16; FLJ36931; SH3 domain binding protein CR16; WAS/WASL interacting protein family member 3; WAS/WASL interacting protein family, member 3; WAS/WASL-interacting protein family member 3; Wipf3
• Common Name: CR16
• Gene Symbol: WIPF3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELSSKSQQATAWTPTQQPGGQLRNGSLHIIDDFESKFTFHSVEDFPPPDEYKPCQKIYPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining