Invitrogen™ Human CRAMP1L (aa 806-904) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP98610	100 μL

Catalog No. RP98610 Supplier Invitrogen™ Supplier No. RP98610

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59709. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CRAMP1 (Cramped Chromatin Regulator Homolog 1) is a Protein Coding gene. Diseases associated with CRAMP1 include Deafness, Autosomal Dominant 40. An important paralog of this gene is ENSG00000261732. [GeneCards].

Specifications

• Accession Number: Q96RY5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57585
• Name: Human CRAMP1L (aa 806-904) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C16orf34; CRAMP1; CRAMP1L; Cramped chromatin regulator homolog 1; Crm, cramped-like; hematological and neurological expressed 1-like protein; HN1L; KIAA1426; Protein cramped-like; TCE4; T-complex expressed gene 4
• Common Name: CRAMP1L
• Gene Symbol: CRAMP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRNPPRPLLVPGPSSTGSNDSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLNSISMQSDFFLPKPRKLRNRHLRKPLVVQRTLLPRPSENQSHN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining