Invitrogen™ Human CREB3L4 (aa 265-370) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89174	100 μL

Catalog No. RP89174 Supplier Invitrogen™ Supplier No. RP89174

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58254. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

cAMP response element-binding (CREB) proteins are a familyof mammalian transcription activators. For further backgroundinformation on CREB proteins, see CREB1 (MIM 123810).[supplied byOMIM].

Specifications

• Accession Number: Q8TEY5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 148327
• Name: Human CREB3L4 (aa 265-370) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1700012K17Rik; 5330432F22Rik; acre1; AIBZIP; Androgen-induced basic leucine zipper protein; androgen-induced bZIP protein; ATCE1; Attaching to CRE-like 1; AV040530; AV258827; cAMP responsive element binding protein 1; cAMP responsive element binding protein 3 like 4; cAMP responsive element binding protein 3-like 4; cAMP-responsive element-binding protein 3-like protein 4; cAMP-responsive element-binding protein 4; CREB3; Creb3l4; CREB4; CREB-4; Cyclic AMP-responsive element-binding protein 3-like protein 4; cyclic AMP-responsive element-binding protein 4; hJAL; JAL; mJAL; OTTHUMP00000035266; Processed cyclic AMP-responsive element-binding protein 3-like protein 4; RP11-422P24.8; Tisp40; transcript induced in spermiogenesis protein 40
• Common Name: CREB3L4
• Gene Symbol: CREB3L4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPPGAKDANGSTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining