Invitrogen™ Human CRMP3 (aa 499-535) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100153	100 μL

Catalog No. RP100153 Supplier Invitrogen™ Supplier No. RP100153

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83947. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Collapsin response mediator proteins (CRMPs), including CRMP-1 (DRP-1), CRMP-2 (DRP-2 or TOAD64), CRMP-3 (DRP-4), CRMP-4 (DRP-3) and CRMP-5 (DRP-5), mediate signal transduction after exposure of neural cells to the axon guidance molecule Semaphorin 3A (SEMA3A)/collapsin. CRMPs are present in the developing cerebral cortex and neocortical neurons and are responsive to SEMA3A. In the adult brain, the expression of CRMPs is dramatically downregulated. However, they remain expressed in structures that retain their capacity for differentiation and plasticity. CRMP-3 is expressed transiently in developing spinal cord and selectively in the postnatal cerebellum.

Specifications

• Accession Number: O14531
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10570
• Name: Human CRMP3 (aa 499-535) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI173505; Collapsin response mediator protein 3; CRMP3; CRMP-3; dihydropyrimidinase like 4; dihydropyrimidinase-like 4; dihydropyrimidinase-related protein 4; DPY4; Dpys4; DPYSL4; DRP-4; ULIP4; ULIP-4; ULIP4 protein; unc-33-like phosphoprotein 4; UNC33-like phosphoprotein 4
• Common Name: CRMP3
• Gene Symbol: DPYSL4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining