Invitrogen™ Human CRSP9 (aa 104-164) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107553	100 μL

Catalog No. RP107553 Supplier Invitrogen™ Supplier No. RP107553

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111619. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: O43513
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 9443
• Name: Human CRSP9 (aa 104-164) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110063B05Rik; Activator-recruited cofactor 34 kDa component; ARC34; Cofactor required for Sp1 transcriptional activation subunit 9; cofactor required for Sp1 transcriptional activation, subunit 9; cofactor required for Sp1 transcriptional activation, subunit 9 (33kD); cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa; CRSP complex subunit 9; Crsp33; crsp9; hMED7; MED7; Mediator complex subunit 7; mediator of RNA polymerase II transcriptio subunit 7-like protein; mediator of RNA polymerase II transcription subunit 7; mediator of RNA polymerase II transcription subunit 7-like; mediator of RNA polymerase II transcription subunit 7-like protein; MGC12284; RNA polymerase transcriptional regulation mediator subunit 7 homolog; Transcriptional coactivator CRSP33; Unknown (protein for MGC:127209); wu:fd99d12; zgc:56241
• Common Name: CRSP9
• Gene Symbol: MED7
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining