Invitrogen™ Human CSN7b (aa 176-260) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102628	100 μL

Catalog No. RP102628 Supplier Invitrogen™ Supplier No. RP102628

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57011. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, JUN, I-kappa-B-alpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.

Specifications

• Accession Number: Q9H9Q2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 64708
• Name: Human CSN7b (aa 176-260) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Arabidopsis; COP9 (constitutive photomorphogenic) homolog, subunit 7b; COP9 (constitutive photomorphogenic) homolog, subunit 7b (Arabidopsis thaliana); COP9 complex S7b; COP9 constitutive photomorphogenic homolog subunit 7B; COP9 signalosome complex subunit 7b; COP9 signalosome subunit 7B; Cops7b; Csn7b; D1Wsu66e; E130114M23; JAB1-containing signalosome subunit 7b; SGN7b; signalosome subunit 7b
• Common Name: CSN7b
• Gene Symbol: COPS7B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining