Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human CSP alpha (aa 1-71) Control Fragment Recombinant Protein

Catalog No. RP90032
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90032 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90032 Supplier Invitrogen™ Supplier No. RP90032
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53025. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cysteine string protein alpha (CSPalpha) is a synaptic vesicle protein that contains a DNA-J domain characteristic of Hsp40 chaperones. Cysteine-string proteins are membrane-bound proteins associated primarily with nerve endings and synaptic vesicles in the brain. These proteins play an important role in presynaptic function and may be involved in calcium-dependent neurotransmitter release. CSP proteins may act as presynaptic chaperones that assist in maintaining synaptic function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H3Z4
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 80331
Name Human CSP alpha (aa 1-71) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2610314I24Rik; AU018536; Ceroid-lipofuscinosis neuronal protein 4; CLN4; CLN4B; Csp; CSP alpha; cysteine string protein; cysteine string protein alpha; DnaJ (Hsp40) homolog, subfamily C, member 5; DnaJ heat shock protein family (Hsp40) member C5; dnaJ homolog subfamily C member 5; Dnajc5; DNAJC5A; mir-941-2; mir-941-3; mir-941-4; mir-941-5; NCL
Common Name CSP alpha
Gene Symbol Dnajc5
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDAT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.